General Information

  • ID:  hor004054
  • Uniprot ID:  P09971(106-122)
  • Protein name:  Beta-SG neuropeptide
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  Expression is restricted to the subesophageal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016084 myostimulatory hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SVAKPQTHESLEFIPRL
  • Length:  17(106-122)
  • Propeptide:  MYKTNIVFNVLALALFSIFFASCTDMKDESDRGAHSERGALWFGPRLGKRSMKPSTEDNRQTFLRLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRSVAKPQTHESLEFIPRLGRRLSEDMPATPADQEMYQPDPEEMESRTRYFSPRLGRTMSFSPRLGRELSYDYPTKYRVARSVNKTMDN
  • Signal peptide:  MYKTNIVFNVLALALFSIFFASC
  • Modification:  T17 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induce diapause egg
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09971-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004054_AF2.pdbhor004054_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 223780 Formula: C88H142N24O26
Absent amino acids: CDGMNWY Common amino acids: ELPS
pI: 7.55 Basic residues: 3
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: -39.41 Boman Index: -3007
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.76
Instability Index: 2150.59 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA